ARL4C

ADP-ribosylation factor-like protein 4C. The canonical sequence contains 192 amino acids.

Sequence and protein regions

Explore the ARL4C sequence, select annotated regions, and copy a request to continue in Codex.

Open this view

RNA expression by cell type

Percentage of cells with detected ARL4C RNA in the public colon adenocarcinoma cell groups.

Macrophages (group B)36.8%

CD8 T cells34.3%

Natural killer cells29.9%

Regulatory T cells29.9%

CD4 T cells26.2%

Dendritic cells22.2%

Macrophages (group A)15.8%

Fibroblasts14.2%

Endothelial cells10.3%

Tumor cells4.2%

Adipocytes4.0%

B cells3.5%

Granulocytes2.4%

RNA detection · Cancer Surfaceome Atlas, Table S6, row 220. Source study · Measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000188042
UniProt accession: P56559
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 192
Sequence SHA-256: 888e83e176548b0610cbf650e95bb62dedbb97fd0759f305a9b2cf55d55a103a

View and select the full canonical sequence

Canonical amino-acid sequence

MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR

Sequence positions 1–192

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Lipid attachment sites

2–2 (N-myristoyl glycine)

This collection has no explicit extracellular interval for this protein.

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: P56559

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell projection, filopodium. Cell membrane. Cytoplasm.
transmembrane: Not recorded
topological_domain: Not recorded
signal_peptide: Not recorded
lipidation: LIPID 2; /note="N-myristoyl glycine"; /evidence="ECO:0000255"

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: ADP-ribosylation factor-like protein 4C
Protein location: Cell membrane, filopodia and cytoplasm
Canonical sequence: P56559 · 192 amino acids

Expression in normal tissues

RNA specificity: Tissue enhanced
RNA distribution: Detected in all
RNA tissue-specific nTPM: bone marrow: 61.3; lymphoid tissue: 68.9
Protein specificity: Group enriched
Protein distribution: Detected in some
Immunohistochemistry reliability: Uncertain
Immunofluorescence reliability: Supported
Protein tissue-specific intensity: cerebral cortex: 2,174,434.6; lymphoid tissue: 585,256.9
Tissue cell-type enrichment: Thyroid gland - T-cells
Subcellular location: Plasma membrane

Human Protein Atlas: ARL4C

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

ARL4C · ENSG00000188042 · P56559