Protein-binder design
Explore protein designs for integrin αvβ6 and CEACAM5. Compare their predicted complexes with published binding interfaces and inspect the recorded design outcomes.
Choose a target
Integrin αvβ6 designs
Inspect generated proteins, their target complexes, and amino-acid sequences.
Explore integrin designs →CEACAM5 designs
Compare proteins generated by three methods and open their saved 3D models.
Explore CEACAM5 designs →Looking for small molecules? View published binding structures and screening poses →
What each design study produced
- Generate proteins16 backbone and sequence designs.
- Predict complexes14 predictions scored; 2 could not be scored.
- Check the interface0 met the reference-site geometry criteria.
- Compare generators3 methods returned 9 candidates.
- Check local geometry4 candidates passed these checks.
- Common independent screenDid not run: FreeBindCraft returned no candidate.
Proteins generated for integrin αvβ6
This campaign generated 16 protein binder designs for integrin αvβ6. Each design has an amino-acid sequence and a three-dimensional model. Open a generated binder, inspect its position against the target, or download its sequence.
The 14 scored complexes failed the binding-site geometry checks. Two further predictions could not be scored.
Prepared target

Generated protein binder

Explore all 16 generated structures
Browse generated binders
Download each image, its source coordinates and render settings. Captions identify the displayed pose type and recorded status.
Generated in this campaign
Integrin binder · design 1A
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-01-mpnn-01 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 1A
Generated in this campaign
Integrin binder · design 1B
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-01-mpnn-02 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 1B
Generated in this campaign
Integrin binder · design 2A
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-02-mpnn-01 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 2A
Generated in this campaign
Integrin binder · design 2B
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-02-mpnn-02 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 2B
Generated in this campaign
Integrin binder · design 3A
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-03-mpnn-01 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 3A
Generated in this campaign
Integrin binder · design 3B
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-03-mpnn-02 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 3B
Generated in this campaign
Integrin binder · design 4A
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-04-mpnn-01 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 4A
Generated in this campaign
Integrin binder · design 4B
72 amino acids · designed for integrin αvβ6

Model check: Complex could not be scored.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-04-mpnn-02 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 4B
Generated in this campaign
Integrin binder · design 5A
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-05-mpnn-01 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 5A
Generated in this campaign
Integrin binder · design 6A
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-06-mpnn-01 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 6A
Generated in this campaign
Integrin binder · design 6B
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-06-mpnn-02 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 6B
Generated in this campaign
Integrin binder · design 7A
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-07-mpnn-01 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 7A
Generated in this campaign
Integrin binder · design 7B
72 amino acids · designed for integrin αvβ6

Model check: Complex could not be scored.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-07-mpnn-02 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 7B
Generated in this campaign
Integrin binder · design 8A
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-08-mpnn-01 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 8A
Generated in this campaign
Integrin binder · design 8B
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-08-mpnn-02 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 8B
Generated in this campaign
Integrin binder · design 5B
72 amino acids · designed for integrin αvβ6

Model check: Binding-site geometry checks failed.
View the 72-amino-acid sequence →
Design method and source ID
Candidate ID: rfd3-8tcg-05-mpnn-02 · Target ID: T-ENSG00000115221
Design tools: RFdiffusion3 + ProteinMPNN.
- Integrin β6 · target
- Integrin αv · target
- Generated binder · design 5B
Candidate scores and reference controls
Candidate measurements
Campaign target: ITGB6.
- Imported candidate records
- 16
- Promoted by recorded decision
- 0
- Control records
- 2
- Scored candidate predictions
- 14
14 candidate predictions scored; 2 candidate predictions failed local scoring; 2 reference-control predictions scored.
Campaign status
Campaign status
- Campaign
- 8tcg-itgav-itgb6-geometry-recovery
- Target
- T-ENSG00000115221
- Execution
- partial
- Control calibration
- passed
- Validated backbones
- 8
- Designed candidates
- 16
- Cofold observations
- 18
- Recorded stop reason
- No generated candidate passed the frozen reference-site geometry gate; finalist rescore was not launched.
Design sequences and model results
| Generated protein | Target and purpose | Protein sequence | Model measurements | Model check | Source files |
|---|---|---|---|---|---|
| Integrin binder · design 1A | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsKLPDLGILRRLVRSVARLAVKLGLEELAKKLLEAFANKDYDEAIKLCEEIKKLAPDSESIHKAIEALKKIKA |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 1B | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsELPDDGILRRLVEACADAAVDLGLEDTAAALRAAFAAKDYDTAIALLEEIKAKDPDNEAITKAITALKAKKA |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 2A | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsSDELKKEADSEIARADYYEAKGKKGNSAYYYDQAAGSYKKAAELYKKLGKEEEAKECNAKAAACQAKADAIR |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 2B | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsAEELKKEADQLAALADYHKARGDKANSAYHYDQAAGAYNKAAELYKKLGNEEKAAEYKAKADAYDAKAKAIR |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 3A | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsMTLEESVAELLAKKAKRPGNRNTARQLTLIAIKLMEEGKLEEALELAEEALKADPNNEAARKVLEEVKKKIA |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 3B | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsMSLEESLARLRAKAAKRPSNRNVARQLALAAIYLAKQGRLEEALAVARAALAADPNNEAARRVLAEVEAKLA |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 4A | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsPSGSQVRGLAGLVARRVQEGTPAAELTALVQASLGLSAAAAAAAVARIAEAAAKRDGVAATRALRDAVRAQR |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 4B | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsPSGSQVRGLAGKIARLIQEGVPREELVARLQASLGLSEAAARAAVDAIAAAAEKLDGVAAYHALVDAVRAER |
| Complex could not be scored | 8 verified files
|
| Integrin binder · design 5A | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsDPLSGAKAKAATLGVLAAVSEVTKETGVEVSEELKSELIKEAKAALEGKAVTAKEAFELAYEIAKKRLLEKV |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 5B | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsAPLSGAKRKAATLGVLAAVSEVEKETGVKVSEETRSELIKKAKEALKGKNVTNKEAFEIAYEIAYKELKEKV |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 6A | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsEKKEKAKELIEEAVRLAKEGKVKEALEKVKEATELADNNPEVALLAYTAVRDAAAGLTDDAERAKKKAVELI |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 6B | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsEKKEKAIKLVEEAVELAARGEVKKARELVKKATELANNNPEFALLADSAVRDAAAGDFDDAARAAKKAAELL |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 7A | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsAEEKIKADPNNSNAWYTLGLEYYAKGNYKEAAEYFEKALAIDPRYVKAHTMLSRVYKKLGNKEKADEIAEKR |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 7B | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsYQAKIAADPNNSRAWYALGKEYFAKGDYKNAAAAFEKAIAIDPTFVQAHTYLSRVYNKLGDKAKADAVAEKR |
| Complex could not be scored | 8 verified files
|
| Integrin binder · design 8A | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsKIEEAIKAAEEGNLEKAIKLAKEAAKLARSNMETVKYLGSAIKAAKEGNLEKAIESLKKALEIAKKRGLEEA |
| Binding-site geometry checks failed | 11 verified files
|
| Integrin binder · design 8B | Integrin αvβ6 (ITGB6)Intended effect: block target activityT-ENSG00000115221 | View 72 amino acidsLIQKAIDAAKAGDLDKAIALLKEAAKKARGNQETVKWIGAAIEAAKAGDLDGAIAAAEKALENAKKAGDTEA |
| Binding-site geometry checks failed | 11 verified files
|
Control records
Recorded campaign target: ITGB6.
| Control | Class | Target | Sequence | Recorded measurements | Files | Claim |
|---|---|---|---|---|---|---|
| control-positive-8tcg-chain-ccontrol-positive-8tcg-chain-c | deposited-positive | Not recorded | 72 aa sequenceCVVRFVFRGDLAELMLRAVKDHLKKEGPHWNITSTNNGKELVVRGIHESDAKRIAKWVEKRFPRVHTETQCD |
| 6 verified files
| computational-design-hypothesis |
| control-negative-composition-shufflecontrol-negative-composition-shuffle | target-matched-negative | Not recorded | 72 aa sequenceVLWGILDSHVHRDLFFTVTPLKGDERCAVWKRHEKRNAVQGEFHKVVGERITMKSNEKRAKDCRPTIVNAEL |
| 6 verified files
| computational-design-hypothesis |
Proteins generated for CEACAM5
Three design methods generated proteins for the published tusamitamab binding site on CEACAM5. Each design has a saved sequence and a model with the target.
The design pose shows the generator’s proposed placement. Four designs also have a separate complex prediction. Two passed its geometry checks; the reference controls failed, so candidate selection stopped. Read the prediction results and controls →
BoltzGen

Design 0164 amino acids
View sequence and download
MTWKVTFSDGRTGTTEGKPEVGKVLTVTYDDGSVSKVEVVEVVDDNTALVRNLETGEEADATAVDownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/boltzgen/smoke/boltzgen-000Design 0264 amino acids
View sequence and download
GTAYATANLTKEEDVVGDIKATVVGTLPGGVKIVKATNLKSGAEVLHDVPGSKETATLAVPSSSDownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/boltzgen/scale/boltzgen-000Design 0364 amino acids
Predicted-complex geometry checks passed.
View sequence and download
MEVTVTITKTSYLTDENIKSIIRSALLKAGVSEEEAEKLAEEALAKIKAAKPKVGETVTVTLKVDownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/boltzgen/scale/boltzgen-001Proteina–Complexa

Design 0164 amino acids
View sequence and download
QAFREFDKDGNGYISTKELGTVMRSLGQNPTEAELQDMINEQDADGDGTISFEEFSTMMRSLGMDownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/proteina-complexa/smoke/proteina-complexa-000Design 0264 amino acids
Predicted-complex geometry checks failed.
View sequence and download
SKLKQLRVEHLERTLLEGVLENGQVTFPTLTAEDYELLRTLPRDKQELLAQRFNVSVESFCPAADownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/proteina-complexa/scale/proteina-complexa-000Design 0364 amino acids
Predicted-complex geometry checks failed.
View sequence and download
NIYLNLALLYEKLGNKEGAAEAYLQAAQIFYQLGNTDLAIKAAEQANKIYEELGDTSKILNLTSDownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/proteina-complexa/scale/proteina-complexa-001PXDesign + ProteinMPNN

Design 0164 amino acids
View sequence and download
SQIDELQAQLQQLQAQLQALVAEAQAAAAAGDKAKLLALLAQTDQLQQQLNQLNQQLVQAKLAADownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/pxdesign-proteinmpnn/smoke/pxdesign-000-proteinmpnn-00Design 0264 amino acids
View sequence and download
SAAKQAIADLVQQAAALVQAHNDQVKAMIESGTYDPEQLKQLQEQLQAQLAALQAQIDAAKAAADownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/pxdesign-proteinmpnn/scale/pxdesign-000-proteinmpnn-00Design 0364 amino acids
Predicted-complex geometry checks passed.
View sequence and download
TPEEEELRKLTEESSKFQKEMEEKAREAVENNDMEKYKKINEETKKKLEEMNKKNAEIRAKLAADownload sequence (FASTA)Source ID: ceacam5-8bw0-multigenerator/pxdesign-proteinmpnn/scale/pxdesign-001-proteinmpnn-00Original design comparison
Three methods generated nine CEACAM5 binders; four passed local geometry checks. The common independent screen did not run because FreeBindCraft returned no candidate.
| Generator | Candidates returned | Local checks |
|---|---|---|
| BoltzGen | 3 | 1 pass · 2 fail |
| Proteina–Complexa | 3 | 2 pass · 1 fail |
| PXDesign + ProteinMPNN | 3 | 1 pass · 2 fail |
| FreeBindCraftExecution failed; no candidate returned | 0 | 0 pass · 0 fail |
PXDesign + ProteinMPNN: The pass count applies the campaign's frozen 2.0 Å heavy-atom clash cutoff; the arm-native summary also reports a separate 2.2 Å warning metric.
Target, local criteria, and source hash
- Target
- CEACAM5
- Target construct
- 8BW0 chain C residues 500-676 normalized to campaign A1-A177
- Target SHA-256
- 3420ce3de4f72f60bdbedba11698551167d21577a0b2cc1a76c6f3a2aa148764
- Site ID
- 8bw0-tusamitamab-a3-b3-face
- Site residues
- 17
- Binder length
- 64
- Maximum target alignment RMSD (Å)
- 2.0
- Maximum heavy-atom clash pairs
- 2
- Minimum heavy-atom contact pairs
- 20
- Minimum full-footprint residues
- 6
- Minimum heavy-chain contact-footprint residues
- 4
- Evidence class
- computational-candidate-hypothesis
- Original outcome SHA-256
- 2df0256aaaee71c25d6e10a23de42d6225ecfe63bf12dd0bd2b6ef8f26cfd889
Predictions with controls
Predictions with controls
A separate study predicted four candidates from the generator comparison with positive and shuffled controls. The controls failed the recorded criteria, which stopped candidate selection.
Reference controls
| Measurement | Positive control | Shuffled control |
|---|---|---|
| Interface score (ipSAE-min) | 0.216434 | 0.0 |
| Reference-site residues contacted | 9 | 13 |
| Target alignment RMSD (Å) | 2.4517 | 1.9697 |
Control identifiers
- Positive control
- control-positive-8bw0-tusamitamab-vh
- Shuffled control
- control-negative-8bw0-vh-composition-shuffle
Recorded failure reasons
- Positive-control ipSAE below the required minimum
- Required footprint-contact margin not met
- Required positive-control ipSAE-min
- 0.25
- Required positive-minus-negative footprint margin (residues)
- 4
Candidates that passed geometry before the control stop
- ceacam5-cp3-boltzgen-03
- ceacam5-cp3-pxdesign-proteinmpnn-03
The failed control gate prevented these candidates from advancing.
Arms without a passing candidate: proteina-complexa.
Scoring recovery and control outcome
- Executed at
- 2026-09-04
- Recorded state
- executed-stop-gate-control-failure
- Local recovery
- Local remeasurement
- Local scoring failure
- The structure predictions completed. Initial interface scoring failed because the target-site definition omitted the required atom selection. Local remeasurement recovered the scores.
- Recovery basis
- The frozen 8BW0 site definition and deposited-interface geometry both use non-hydrogen atom contacts; no site, cutoff, chain, model, seed, or gate changed.
- Evidence class
- computational-candidate-hypothesis
Paired antibody-domain controls
Paired-variable-domain control diagnostic
Stopped after 1 of 6 predictions
The CEACAM5 + VH + VL positive-control prediction completed. A local scoring incompatibility stopped the run before the negative-control or repeat predictions were issued.
VH and VL are the variable domains of the antibody’s heavy and light chains.
- The construct is paired VH+VL/Fv-like context: A=CEACAM5 177 aa, B=VH 117 aa, C=VL 104 aa.
- One structure prediction completed, with four verified structure and confidence files.
- A separate local analysis treated antibody chains B and C as one partner. It returned a group interface score (ipSAE-min) of 0.0, contacts with 12 of 17 reference-site residues, and a target-alignment RMSD of 2.1726 Å.
- The full two-control, three-seed panel is incomplete and was not qualified.
- No generated candidates were included or promoted.
Source records and measurement details
- Campaign ID
- ceacam5-8bw0-paired-fv-context-diagnostic
- Executed on
- 2026-09-04
- Execution
- {"authorized_predictions":6,"completed_control":"positive","completed_predictions":1,"completed_seed":20260931,"issued_predictions":1,"unissued_predictions":5}
- Paired-group measurement
- {"full_footprint_contact_count":12,"full_footprint_residue_count":17,"group_ipsae_min":0.0,"interpretation":"One positive observation cannot evaluate a six-observation paired-control panel. It does not support an inference about paired versus single-variable-domain context.","state":"measured-single-positive-only","target_alignment_rmsd_angstrom":2.1726}
- Panel qualification
- {"failed_gate_assessment":"not-run","generated_candidates":0,"promotions":0,"qualified":false,"state":"not-evaluable-incomplete-panel"}
- Relationship to completed checkpoint
- none; the existing three-arm checkpoint was not modified or reinterpreted
- Original-source hashes
- {"role":"report-handoff","sha256":"72f9d08fc68ec10f46440638ccffdb5b84e44e7b42504375496171e05fef02c2","verification":"hash computed from selected source bytes"}, {"role":"diagnostic-outcome","sha256":"c0cff32084c2f5a030bdda3dfc89afe9b8fb7dad1a0f96816bca1643b1f0f860","verification":"hash computed from selected source bytes"}, {"role":"diagnostic-plan","sha256":"be3b63444df4f9b6f1967c087cd3f0cff2a6baa6a13678e9ed4faeb2a0ee28c5","verification":"hash declared by outcome; artifact not read for this projection"}, {"role":"complex-pdb","sha256":"3f188d647fadc176a3445151ec0e0a7821bf2f6b92dd92546ba2e05275cf12e4","verification":"hash declared by outcome; artifact not read for this projection"}, {"role":"pae-json","sha256":"98b8517022d6ecc5e9e54660069dffa46ba430da9d55f14ab099eebc57e72a04","verification":"hash declared by outcome; artifact not read for this projection"}, {"role":"paired-group-measurement","sha256":"77b9b238c69ec8d6fe6da7b0bfb8f5cd46105b09f971f6354f0ab5983228b1c6","verification":"hash declared by outcome; artifact not read for this projection"}
- Source records
- Source hashes identify the original input records.
Replacement-generator study
Replacement generator results
| Candidates passing geometry checks | 0 |
|---|---|
| Independent validation requests | 0 |
| Promoted candidates | 0 |
ESMFold2: unconditioned generation. This arm did not condition generation on the target site.
- Genie3 stopped after its initial test: target-coordinate recovery RMSD was 0.0224 Å against a 0.001 Å maximum.
- ProteinMPNN and Genie3 scale were not called.
- ESMFold2-design remained a separate unconditioned exploratory arm and was not compared as site-conditioned.
- All three ESMFold2 candidates failed unchanged full-footprint and VH-subsite gates, so no independent predictor calls were made.
- No candidate was promoted.
Result records and hashes
- Campaign ID
- ceacam5-8bw0-replacement-generators-20260904
- Recorded status
- complete-no-promotions
- Results
- {"esmfold2_unconditioned_64aa_candidates":3,"genie3_ca_traces":1,"genie3_gate_passers":0,"geometry_passers":0,"independent_validation_eligible":0,"promotions":0}
- Claim ceiling
- computational-screening-hypothesis
- Original outcome SHA-256
- 5356c67f95caf227d74f35e113e79ce7b174f61794ffd8b19e9cb18b368e983e
- Declared artifact hashes
- {"campaign_plan":"9483f45c0dd767d30078508830fe006c88d87cd5d76e1f931ad89be5950a34e1","cleanup_snapshot":"322bbb6d2e1d6804b845a2a830699714cea319e189d0a7c820d8a055ec606982","esmfold2_geometry_metrics":"07b86c028edd35bac9caea65b6bcfcf013dfdca698d25882f80757093a25e1ef","esmfold2_normalized_manifest":"c6cfc85ff4d4cafcfca8aeab8b3064f882cf6cbda91940b2921082292fe88652","genie3_smoke_audit":"daa7114a1c5033bab1148c64203c500b7d7497dba8377ae21ac9121df4fee1cf","preflight":"cdf994e5ea28d0eee2e3c16a1fc12c88d202a9a13484c1d151db8449c56612d3"}
- Declared final-summary SHA-256
- ace5d509f41dfb566aaa49240fe231eddafa1b8d80fad6fe58e95cfd89acd78f
- Artifact verification
- Hashes declared by the outcome; referenced artifacts were not read for this projection.
- Source records
- The source hash identifies the original outcome record.
Candidate sequences and downloadable records
Candidate and control sequences
Download the original FASTA files or copy an amino acid sequence.
CEACAM5 checkpoint candidates and controls
BoltzGen 03
Designed candidate · chain B · 64 amino acids
ceacam5-cp3-boltzgen-03
Show sequence
MEVTVTITKTSYLTDENIKSIIRSALLKAGVSEEEAEKLAEEALAKIKAAKPKVGETVTVTLKV
Proteina–Complexa 02
Designed candidate · chain B · 64 amino acids
ceacam5-cp3-proteina-complexa-02
Show sequence
SKLKQLRVEHLERTLLEGVLENGQVTFPTLTAEDYELLRTLPRDKQELLAQRFNVSVESFCPAA
Proteina–Complexa 03
Designed candidate · chain B · 64 amino acids
ceacam5-cp3-proteina-complexa-03
Show sequence
NIYLNLALLYEKLGNKEGAAEAYLQAAQIFYQLGNTDLAIKAAEQANKIYEELGDTSKILNLTS
PXDesign–ProteinMPNN 03
Designed candidate · chain B · 64 amino acids
ceacam5-cp3-pxdesign-proteinmpnn-03
Show sequence
TPEEEELRKLTEESSKFQKEMEEKAREAVENNDMEKYKKINEETKKKLEEMNKKNAEIRAKLAA
Tusamitamab heavy-chain variable domain (VH)
Positive control · chain B · 117 amino acids
control-positive-8bw0-tusamitamab-vh
Show sequence
VQLQESGPGLVKPGGSLSLSCAASGFVFSSYDMSWVRQTPERGLEWVAYISSGGGITYAPSTVKGRFTVSRDNAKNTLYLQMNSLTSEDTAVYYCAAHYFGSSGPFAYWGQGTLVTV
Shuffled tusamitamab VH
Negative control · chain B · 117 amino acids
control-negative-8bw0-vh-composition-shuffle
Show sequence
DEYLPGYGNRVVGSLSSQCESGTWVHVGVRLREYTLYLPTRYSGLSMYSYCANASTGGASKLFFQGITAPTDIVTNGKMAAQAGTGAPGKSEPLVSSFSAVSWYQLVFTWDGQVSFS
Paired control: heavy-chain variable domain (VH)
Paired antibody control · chain B · 117 amino acids
control-positive-8bw0-paired-vh-vl
Show sequence
VQLQESGPGLVKPGGSLSLSCAASGFVFSSYDMSWVRQTPERGLEWVAYISSGGGITYAPSTVKGRFTVSRDNAKNTLYLQMNSLTSEDTAVYYCAAHYFGSSGPFAYWGQGTLVTV
Paired control: light-chain variable domain (VL)
Paired antibody control · chain C · 104 amino acids
control-positive-8bw0-paired-vh-vl:vl
Show sequence
DIQMTQSPASLSASVGDRVTITCRASENIFSYLAWYQQKPGKSPKLLVYNTRTLAEGVPSRFSGSGSGTDFSLTISSLQPEDFATYYCQHHYGTPFTFGSGTKL
Design data
The exports preserve imported sequences, measurements, model versions, decisions, and source payloads.
Candidate sequences and design poses
Recover each candidate’s amino-acid sequence and generated design pose. Candidate IDs include the campaign, generator arm and run stage.
Download candidate file indexBoltzGen
ceacam5-8bw0-multigenerator
boltzgen-000 · smoke
Campaign tool: BoltzGen.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/boltzgen/smoke/boltzgen-000
- Sequence SHA-256
- 28152b2f7418717c770fce2bb3522edb44b1e0b4b1aaafeb5e22cf802452ac57
- Original manifest SHA-256
- 25f7d4ffc507df18384e92a53554ae5d654348355740e2d9f3b5ecd7b412b5f5
- Original pose SHA-256
- 34c405561f55e41909a0f13fb04fa9abd6c5f0a25df7fa64281bf735bcf9da3e
- Packaged pose SHA-256
- 34c405561f55e41909a0f13fb04fa9abd6c5f0a25df7fa64281bf735bcf9da3e
- Observed protein-chain lengths
- {"A":177,"B":64}
boltzgen-000 · scale
Campaign tool: BoltzGen.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/boltzgen/scale/boltzgen-000
- Sequence SHA-256
- f3e48bd663bfecfb774556bbd3c8537fba17265d4869eaaf422fda1eb3b99455
- Original manifest SHA-256
- ce59cdb6e4c27c71b0a453a23733d874adef5f845376405878d2cd3f631f7af4
- Original pose SHA-256
- e61bd7d95f6c3f5e63bd0287696176fd6e146860f9624a93ee2ffbdc32ef7b9b
- Packaged pose SHA-256
- e61bd7d95f6c3f5e63bd0287696176fd6e146860f9624a93ee2ffbdc32ef7b9b
- Observed protein-chain lengths
- {"A":177,"B":64}
boltzgen-001 · scale
Campaign tool: BoltzGen.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/boltzgen/scale/boltzgen-001
- Sequence SHA-256
- ccc912f3587e2527d082c7e39b439feda882f3a71a006545ee7561754977fcd2
- Original manifest SHA-256
- ce59cdb6e4c27c71b0a453a23733d874adef5f845376405878d2cd3f631f7af4
- Original pose SHA-256
- 2c2ce0876e1495fa8014ff72e2d33071b1379585d9af004d9d4ae5d4326fb07f
- Packaged pose SHA-256
- 2c2ce0876e1495fa8014ff72e2d33071b1379585d9af004d9d4ae5d4326fb07f
- Observed protein-chain lengths
- {"A":177,"B":64}
Proteina–Complexa
ceacam5-8bw0-multigenerator
proteina-complexa-000 · smoke
Campaign tool: Proteina–Complexa.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/proteina-complexa/smoke/proteina-complexa-000
- Sequence SHA-256
- f3fcb1023fa52085b79f633d631390733c868ee809fa84a0765cc5718691e443
- Original manifest SHA-256
- e8b3451955d98b9ac7f8f659acf3bea931b8874b7db5fa6cb029e9384e83e15c
- Original pose SHA-256
- a7b368ee080db8d30c21df05180ce704cbe2585f88f8071641b9742852e4ff99
- Packaged pose SHA-256
- a7b368ee080db8d30c21df05180ce704cbe2585f88f8071641b9742852e4ff99
- Observed protein-chain lengths
- {"A":177,"B":64}
proteina-complexa-000 · scale
Campaign tool: Proteina–Complexa.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/proteina-complexa/scale/proteina-complexa-000
- Sequence SHA-256
- 238c73b712b8664a3722299b5ed7cc094548c5723ff37792d7e5b5d1d0c42414
- Original manifest SHA-256
- 7b1a74b161ad50d73e83e09fc919f49c97d417349c6d174825f67f261e1a38fa
- Original pose SHA-256
- cd6f93802c466ab7e0c2f79f58c1563e3938edf92b661770d5de9e10d5974a4d
- Packaged pose SHA-256
- cd6f93802c466ab7e0c2f79f58c1563e3938edf92b661770d5de9e10d5974a4d
- Observed protein-chain lengths
- {"A":177,"B":64}
proteina-complexa-001 · scale
Campaign tool: Proteina–Complexa.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/proteina-complexa/scale/proteina-complexa-001
- Sequence SHA-256
- 493fcdfa980f4f969d0729a1fc59983ebfc076b1b3100ef4610e6383034dcff0
- Original manifest SHA-256
- 7b1a74b161ad50d73e83e09fc919f49c97d417349c6d174825f67f261e1a38fa
- Original pose SHA-256
- 6fe046449c149dab304990ea2e7bd7074e076ffc4552e78a13c178b7423516d1
- Packaged pose SHA-256
- 6fe046449c149dab304990ea2e7bd7074e076ffc4552e78a13c178b7423516d1
- Observed protein-chain lengths
- {"A":177,"B":64}
PXDesign + ProteinMPNN
ceacam5-8bw0-multigenerator
pxdesign-000-proteinmpnn-00 · smoke
Campaign tool: PXDesign + ProteinMPNN.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/pxdesign-proteinmpnn/smoke/pxdesign-000-proteinmpnn-00
- Sequence SHA-256
- b35b51b58394aca742cc52fbc6b007dc46becd6b54a1ba309638b32035d7c890
- Original manifest SHA-256
- 20a58ba531e6dd334ae3d8fa10ecbfc86f73cd4c7eb074f923dae39e25857c12
- Original pose SHA-256
- f48fdd7750b42edb7de1fbdb17c73ed1e73f2ac9af865d2168e308a847eaeea2
- Packaged pose SHA-256
- b37beb34cc69cee7a56382116e29badb68cb6250d2bc2f9e78f5c40c0a5e7863
- Observed protein-chain lengths
- {"A":177,"B":64}
pxdesign-000-proteinmpnn-00 · scale
Campaign tool: PXDesign + ProteinMPNN.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/pxdesign-proteinmpnn/scale/pxdesign-000-proteinmpnn-00
- Sequence SHA-256
- b27052a7063360ba8a2da4b62d37e8a782f3c3826b7065dff1f3f14fdff2e119
- Original manifest SHA-256
- b332a91243e635cc40f60393259a43a198d3f9b625f74f081d0ae862da6d42c6
- Original pose SHA-256
- 35d27a471df43f69e27c548c4a266e11c3dd513475dc348c2d5454487a1d3289
- Packaged pose SHA-256
- 738068413ec8f8c5da845b8c3791eadc800c5d18c50b40350e0e87354da08caf
- Observed protein-chain lengths
- {"A":177,"B":64}
pxdesign-001-proteinmpnn-00 · scale
Campaign tool: PXDesign + ProteinMPNN.
64 amino acids · Generated design pose · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-multigenerator/pxdesign-proteinmpnn/scale/pxdesign-001-proteinmpnn-00
- Sequence SHA-256
- 6e14cddf2dc1b16095def35925cc6bd00a51174f17e4596200671bd4b0916413
- Original manifest SHA-256
- b332a91243e635cc40f60393259a43a198d3f9b625f74f081d0ae862da6d42c6
- Original pose SHA-256
- 0e16974db57d524c3d1405f60c33f4d258a827374a64815ed5372dd01b7409dd
- Packaged pose SHA-256
- 4915edf92a1efeadd2b73edf7e0f6ffe49df08835262d848de9d5c0c8f9d6a82
- Observed protein-chain lengths
- {"A":177,"B":64}
esmfold2-fast-unconditioned
ceacam5-8bw0-replacement-generators-20260904
esmfold2-unconditioned-001 · smoke
64 amino acids · Predicted sequence fold · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-replacement-generators-20260904/esmfold2-fast-unconditioned/smoke/esmfold2-unconditioned-001
- Sequence SHA-256
- 32e9f4fba2f34565443d17a74790b7d21d1d2a9807a9ac717e4104d2f58abe7d
- Original manifest SHA-256
- c6cfc85ff4d4cafcfca8aeab8b3064f882cf6cbda91940b2921082292fe88652
- Original pose SHA-256
- 1122412e01897edc09751158d332caf65bb72b25374acc6f8ed38f6325d24933
- Packaged pose SHA-256
- 1122412e01897edc09751158d332caf65bb72b25374acc6f8ed38f6325d24933
- Observed protein-chain lengths
- {"A":177,"B":64}
esmfold2-unconditioned-002 · scale
64 amino acids · Predicted sequence fold · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-replacement-generators-20260904/esmfold2-fast-unconditioned/scale/esmfold2-unconditioned-002
- Sequence SHA-256
- 15ce01b4c21a6b6745a4dbf4e358d7cf99b4883ce7042419cef3d3e2e99b8a6d
- Original manifest SHA-256
- c6cfc85ff4d4cafcfca8aeab8b3064f882cf6cbda91940b2921082292fe88652
- Original pose SHA-256
- 80a72746911d491a0051d9ec08febc959098335e772ae15b350ca1ffe849e926
- Packaged pose SHA-256
- 80a72746911d491a0051d9ec08febc959098335e772ae15b350ca1ffe849e926
- Observed protein-chain lengths
- {"A":177,"B":64}
esmfold2-unconditioned-003 · scale
64 amino acids · Predicted sequence fold · Sequence matches chain B

· Download PNG · Download render settings
Download FASTA · Download generated design pose (PDB)
Exact identifiers and file hashes
- Qualified candidate ID
- ceacam5-8bw0-replacement-generators-20260904/esmfold2-fast-unconditioned/scale/esmfold2-unconditioned-003
- Sequence SHA-256
- 325ae69ed9e8cd72f1e16ac656d14cbac3b027963a558e6f66e8ec2b7741cc7d
- Original manifest SHA-256
- c6cfc85ff4d4cafcfca8aeab8b3064f882cf6cbda91940b2921082292fe88652
- Original pose SHA-256
- b9c391ed3513b318caf321bbdeb2c6f261cd601ced46d7429664540563a9b1f3
- Packaged pose SHA-256
- b9c391ed3513b318caf321bbdeb2c6f261cd601ced46d7429664540563a9b1f3
- Observed protein-chain lengths
- {"A":177,"B":64}