B2M

Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]. The canonical sequence contains 119 amino acids.

Sequence and protein regions

Explore the B2M sequence, select annotated regions, and copy a request to continue in Codex.

Open this view

RNA expression by cell type

Percentage of cells with detected B2M RNA in the public colon adenocarcinoma cell groups.

CD8 T cells99.8%

Granulocytes99.7%

CD4 T cells99.6%

Regulatory T cells99.6%

Endothelial cells99.5%

Dendritic cells99.3%

Macrophages (group B)99.2%

B cells99.1%

Natural killer cells99.0%

Fibroblasts98.5%

Macrophages (group A)97.9%

Adipocytes97.3%

Tumor cells89.9%

RNA detection · Cancer Surfaceome Atlas, Table S6, row 126. Source study · Measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000166710
UniProt accession: P61769
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 119
Sequence SHA-256: c319ce623de7d59e9e73c6daf7ec603d5e5ed48358f54b97d1eccdc3c9bf693b

View and select the full canonical sequence

Canonical amino-acid sequence

MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

Sequence positions 1–119

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Signal peptide

1–20

This collection has no explicit extracellular interval for this protein.

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: P61769

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:1336137, ECO:0000269|PubMed:7554280}. Cell surface {ECO:0000269|PubMed:25356553}. Note=Detected in serum and urine (PubMed:1336137, PubMed:7554280). {ECO:0000269|PubMed:7554280, ECO:0000269|Ref.6}.; SUBCELLULAR LOCATION: Note=(Microbial infection) In the presence of M.tuberculosis EsxA-EsxB complex decreased amounts of B2M are found on the cell surface (PubMed:25356553). {ECO:0000269|PubMed:25356553}.
transmembrane: Not recorded
topological_domain: Not recorded
signal_peptide: SIGNAL 1..20; /evidence="ECO:0000269|PubMed:1336137, ECO:0000269|PubMed:25946035, ECO:0000269|PubMed:3532124, ECO:0000269|PubMed:4586824, ECO:0000269|PubMed:8084451"
lipidation: Not recorded

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]
Protein location: Secreted; cell surface
Canonical sequence: P61769 · 119 amino acids

Expression in normal tissues

RNA specificity: Low tissue specificity
RNA distribution: Detected in all
Protein specificity: Low tissue specificity
Protein distribution: Detected in all
Immunohistochemistry reliability: Enhanced
Immunofluorescence reliability: Enhanced
Tissue cell-type enrichment: Skeletal muscle - Endothelial cells, Thyroid gland - T-cells
Subcellular location: Golgi apparatus, Plasma membrane

Human Protein Atlas: B2M

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

B2M · ENSG00000166710 · P61769