CD82

CD82 antigen. UniProt annotates extracellular residues 33–53, 111–228.

Sequence and protein regions

Explore the CD82 sequence, select annotated regions, and copy a request to continue in Codex.

Open this view

RNA expression by cell type

Percentage of cells with detected CD82 RNA in the public colon adenocarcinoma cell groups.

Granulocytes35.1%

Regulatory T cells28.1%

Tumor cells21.5%

Fibroblasts17.8%

CD4 T cells16.6%

Macrophages (group B)16.6%

CD8 T cells15.5%

B cells14.3%

Dendritic cells9.8%

Macrophages (group A)8.3%

Endothelial cells7.8%

Adipocytes5.4%

Natural killer cells3.3%

RNA detection · Cancer Surfaceome Atlas, Table S6, row 421. Source study · Measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000085117
UniProt accession: P27701
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 267
Sequence SHA-256: de9a6cfaa5ba398a00340c981b0058f26010169f0f74ef672c695e4846b65416

View and select the full canonical sequence

Canonical amino-acid sequence

MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY

Sequence positions 1–267

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Membrane-spanning segments

12–32 (Helical); 54–72 (Helical); 84–110 (Helical); 229–250 (Helical)

Source-annotated domains

1–11 (Cytoplasmic); 33–53 (Extracellular); 73–83 (Cytoplasmic); 111–228 (Extracellular); 251–267 (Cytoplasmic)

Lipid attachment sites

5–5 (S-palmitoyl cysteine); 74–74 (S-palmitoyl cysteine)

Source-annotated extracellular intervals

33–53; 111–228

UniProt annotates the following extracellular intervals.

One-based positions include both interval endpoints.
Start	End	Length	Sequence and source
33	53	21	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 ee78e8f5439178addd21bc9f492840b127d588f795c94a6123f2165c9714cd8e Amino-acid sequence for this intervalWILADKSSFISVLQTSSSSLR
111	228	118	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 d4c116c421be26ebf28ab3c6185c05f46ef21334daac3bd9433c49e94dc0b2db Amino-acid sequence for this intervalGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENL

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: P27701

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:19497983, ECO:0000269|PubMed:23897813, ECO:0000269|PubMed:30463011, ECO:0000269|PubMed:34530889, ECO:0000269|PubMed:8757325, ECO:0000269|Ref.4}; Multi-pass membrane protein {ECO:0000255}. Cytoplasmic vesicle, phagosome {ECO:0000250|UniProtKB:P40237}.
transmembrane: TRANSMEM 12..32; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 54..72; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 84..110; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 229..250; /note="Helical"; /evidence="ECO:0000255"
topological_domain: TOPO_DOM 1..11; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 33..53; /note="Extracellular"; /evidence="ECO:0000255"; TOPO_DOM 73..83; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 111..228; /note="Extracellular"; /evidence="ECO:0000255"; TOPO_DOM 251..267; /note="Cytoplasmic"; /evidence="ECO:0000255"
signal_peptide: Not recorded
lipidation: LIPID 5; /note="S-palmitoyl cysteine"; /evidence="ECO:0000269|PubMed:35538033"; LIPID 74; /note="S-palmitoyl cysteine"; /evidence="ECO:0000269|PubMed:35538033"

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: CD82 antigen
Protein location: Transmembrane protein
Canonical sequence: P27701 · 267 amino acids
Extracellular region: UniProt annotates extracellular residues 33–53, 111–228.

Expression in normal tissues

RNA specificity: Low tissue specificity
RNA distribution: Detected in all
Protein specificity: Low tissue specificity
Protein distribution: Detected in many
Immunohistochemistry reliability: Supported
Immunofluorescence reliability: Uncertain
Tissue cell-type enrichment: Liver - Hepatocytes, Spleen - Macrophages
Subcellular location: Vesicles

Human Protein Atlas: CD82

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

CD82 · ENSG00000085117 · P27701