CLDN4

Claudin-4. UniProt annotates extracellular residues 29–81, 139–160.

Predicted protein structure

A downloaded AlphaFold model connects the CLDN4 sequence to its predicted three-dimensional structure.

Open this view

RNA expression by cell type

Percentage of cells with detected CLDN4 RNA in the public colon adenocarcinoma cell groups.

Tumor cells46.3%

Macrophages (group B)11.2%

Fibroblasts11.2%

Endothelial cells9.4%

Dendritic cells9.2%

Macrophages (group A)7.2%

Regulatory T cells6.8%

B cells6.7%

CD4 T cells6.7%

Natural killer cells6.4%

CD8 T cells5.9%

Granulocytes4.8%

Adipocytes4.7%

RNA detection · Cancer Surfaceome Atlas, Table S6, row 226. Source study · Measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000189143
UniProt accession: O14493
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 209
Sequence SHA-256: 8cb61c933367dd678b240bd214da8f4c46fa63507dd8f4bbdb561fc9c1ce0ba4

View and select the full canonical sequence

Canonical amino-acid sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Sequence positions 1–209

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Membrane-spanning segments

8–28 (Helical); 82–102 (Helical); 118–138 (Helical); 161–181 (Helical)

Source-annotated domains

1–7 (Cytoplasmic); 29–81 (Extracellular); 103–117 (Cytoplasmic); 139–160 (Extracellular); 182–209 (Cytoplasmic)

Source-annotated extracellular intervals

29–81; 139–160

UniProt annotates the following extracellular intervals.

One-based positions include both interval endpoints.
Start	End	Length	Sequence and source
29	81	53	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 1325abd888d158abeed4cda75651e3c5725cf9d52e4575dd3165155754b618fb Amino-acid sequence for this intervalMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
139	160	22	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 00034b2f6a8792d04b315260f3680de369cdb0a5bbed96911f3fdc004e1c6414 Amino-acid sequence for this intervalTAHNIIQDFYNPLVASGQKREM

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: O14493

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell junction, tight junction {ECO:0000269|PubMed:30734065}. Cell membrane {ECO:0000269|PubMed:20375010}; Multi-pass membrane protein {ECO:0000255}.
transmembrane: TRANSMEM 8..28; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 82..102; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 118..138; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 161..181; /note="Helical"; /evidence="ECO:0000255"
topological_domain: TOPO_DOM 1..7; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 29..81; /note="Extracellular"; /evidence="ECO:0000255"; TOPO_DOM 103..117; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 139..160; /note="Extracellular"; /evidence="ECO:0000255"; TOPO_DOM 182..209; /note="Cytoplasmic"; /evidence="ECO:0000255"
signal_peptide: Not recorded
lipidation: Not recorded

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: Claudin-4
Protein location: Transmembrane protein
Canonical sequence: O14493 · 209 amino acids
Extracellular region: UniProt annotates extracellular residues 29–81, 139–160.

Expression in normal tissues

RNA specificity: Tissue enhanced
RNA distribution: Detected in many
RNA tissue-specific nTPM: esophagus: 317.9; intestine: 265.3; urinary bladder: 282.7
Protein specificity: Tissue enriched
Protein distribution: Detected in some
Immunohistochemistry reliability: Enhanced
Immunofluorescence reliability: Supported
Protein tissue-specific intensity: lung: 440,862.9
Tissue cell-type enrichment: Colon - Colon enterocytes, Liver - Cholangiocytes, Lung - Alveolar cells type 2, Minor Salivary Gland - Minor salivary glandular cells, Pancreas - Ductal cells, Skin - Keratinocyte (granular)
Subcellular location: Plasma membrane

Human Protein Atlas: CLDN4

Structures

A predicted target model is available.

Browse related molecular views

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

CLDN4 · ENSG00000189143 · O14493