TSPAN8

Tetraspanin-8. UniProt annotates extracellular residues 34–57, 110–205.

Predicted protein structure

A downloaded AlphaFold model connects the TSPAN8 sequence to its predicted three-dimensional structure.

Open this view

RNA expression by cell type

Percentage of cells with detected TSPAN8 RNA in the public colon adenocarcinoma cell groups.

Tumor cells63.7%

Macrophages (group B)16.3%

Fibroblasts15.6%

Endothelial cells12.7%

Dendritic cells12.4%

Regulatory T cells12.3%

Macrophages (group A)11.4%

CD8 T cells10.8%

Natural killer cells9.3%

CD4 T cells9.1%

B cells8.9%

Adipocytes7.8%

Granulocytes7.7%

RNA detection · Cancer Surfaceome Atlas, Table S6, row 378. Source study · Measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000127324
UniProt accession: P19075
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 237
Sequence SHA-256: 52cd31489fca498b1fa74914c387351d8810a277639616ddbad78b9bb4ffb948

View and select the full canonical sequence

Canonical amino-acid sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

Sequence positions 1–237

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Membrane-spanning segments

10–33 (Helical); 58–72 (Helical); 84–109 (Helical); 206–230 (Helical)

Source-annotated domains

1–9 (Cytoplasmic); 34–57 (Extracellular); 73–83 (Cytoplasmic); 110–205 (Extracellular); 231–237 (Cytoplasmic)

Source-annotated extracellular intervals

34–57; 110–205

UniProt annotates the following extracellular intervals.

One-based positions include both interval endpoints.
Start	End	Length	Sequence and source
34	57	24	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 05ffc027bd1a450d0dd6339c237b994b3265093117e560ee5aeb2a85dc270632 Amino-acid sequence for this intervalRVSNDSQAIFGSEDVGSSSYVAVD
110	205	96	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 0c3eb851cd846339c0f333fd056f5eafdea02a3dfc63eec3536885ac2de051e0 Amino-acid sequence for this intervalKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: P19075

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:27180357, ECO:0000269|PubMed:34524408, ECO:0000269|PubMed:37204469, ECO:0000269|PubMed:37835445}; Multi-pass membrane protein.
transmembrane: TRANSMEM 10..33; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 58..72; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 84..109; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 206..230; /note="Helical"; /evidence="ECO:0000255"
topological_domain: TOPO_DOM 1..9; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 34..57; /note="Extracellular"; /evidence="ECO:0000255"; TOPO_DOM 73..83; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 110..205; /note="Extracellular"; /evidence="ECO:0000255"; TOPO_DOM 231..237; /note="Cytoplasmic"; /evidence="ECO:0000255"
signal_peptide: Not recorded
lipidation: Not recorded

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: Tetraspanin-8
Protein location: Transmembrane protein
Canonical sequence: P19075 · 237 amino acids
Extracellular region: UniProt annotates extracellular residues 34–57, 110–205.

Expression in normal tissues

RNA specificity: Tissue enhanced
RNA distribution: Detected in many
RNA tissue-specific nTPM: intestine: 891.6; stomach 1: 595.5
Protein specificity: Group enriched
Protein distribution: Detected in many
Immunohistochemistry reliability: Enhanced
Immunofluorescence reliability: Approved
Protein tissue-specific intensity: Stomach: 25,049,876.5; intestine: 20,561,122.9
Tissue cell-type enrichment: Colon - Colon enterocytes, Minor Salivary Gland - Minor salivary glandular cells, Prostate - Prostate glandular cells, Stomach - Gastric mucous cells
Subcellular location: Vesicles

Human Protein Atlas: TSPAN8

Structures

A predicted target model is available.

Browse related molecular views

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

TSPAN8 · ENSG00000127324 · P19075