BLNK

B-cell linker protein. The canonical sequence contains 456 amino acids.

Sequence and protein regions

Explore the BLNK sequence, select annotated regions, and copy a request to continue in Codex.

RNA expression in tumor samples

Median BLNK RNA expression by tumor type, measured in RSEM units. The study selected these samples using microsatellite-stability score thresholds.

Mucinous tumors37 samples261.1

Other tumor types438 samples213.4

Compare the sample groups · cBioPortal measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000095585
UniProt accession: Q8WV28
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 456
Sequence SHA-256: 88b72891e4b06f47127efec536e5e44da0f4235794827789251122a59dbbef2d

View and select the full canonical sequence

Canonical amino-acid sequence

MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS

This collection has no explicit extracellular interval for this protein.

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: Q8WV28

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:9697839}. Cell membrane {ECO:0000269|PubMed:9697839}. Note=BCR activation results in the translocation to membrane fraction.
transmembrane: Not recorded
topological_domain: Not recorded
signal_peptide: Not recorded
lipidation: Not recorded

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: B-cell linker protein
Protein location: Cytoplasm and cell membrane
Canonical sequence: Q8WV28 · 456 amino acids

Expression in normal tissues

RNA specificity: Tissue enhanced
RNA distribution: Detected in many
RNA tissue-specific nTPM: lymphoid tissue: 52.9
Protein specificity: Tissue enriched
Protein distribution: Detected in single
Immunohistochemistry reliability: Enhanced
Immunofluorescence reliability: Supported
Protein tissue-specific intensity: lymphoid tissue: 3,414,268.5
Tissue cell-type enrichment: Adrenal gland - Macrophages, Spleen - B-cells (Spleen), Stomach - Gastric mucous cells
Subcellular location: Plasma membrane

Human Protein Atlas: BLNK

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

BLNK · ENSG00000095585 · Q8WV28