CEACAM5

CEACAM5 is a cell adhesion protein attached to the cell surface by a lipid anchor.

Protein-binder design

Three methods generated nine CEACAM5 proteins. Reference controls failed in the later prediction study, which stopped candidate selection.

View campaign results

RNA expression in tumor samples

Median CEACAM5 RNA expression by tumor type, measured in RSEM units. The study selected these samples using microsatellite-stability score thresholds.

Mucinous tumors37 samples111,126.0

Other tumor types438 samples117,586.6

Compare the sample groups · cBioPortal measurements (JSON)

Inspect the molecular structure

Published reference structure

CEACAM5 with tusamitamab

Deposited structure 8BW0. The CEACAM5 A3-B3 fragment is shown with the tusamitamab Fab.

PDB entry: 8BW0
Target ID: T-ENSG00000105388

tusamitamab Fab heavy chain · chain H (ribbon)
tusamitamab Fab light chain · chain L (ribbon)
CEACAM5 A3-B3 domains · chain C (ribbon)

Download PNG · Download settings · Source coordinates (CIF)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000105388
UniProt accession: P06731
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 702
Sequence SHA-256: 1d589a5cfe8738ca20f7b2a4658dceebfb6741b489707df585481e190c2d462c

View and select the full canonical sequence

Canonical amino-acid sequence

MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI

Sequence positions 1–702

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Signal peptide

1–34

Lipid attachment sites

676–676 (GPI-anchor amidated alanine)

Derived extracellular interval

35–675

The extracellular interval is derived from the signal peptide and GPI attachment site. It is a proposed construct interval.

One-based positions include both interval endpoints.
Start	End	Length	Sequence and source
35	675	641	Sequence and source Basis interval-after-reviewed-signal-before-reviewed-gpi-anchor Evidence class topology-derived-construct-hypothesis Sequence SHA-256 24c25539d3067ff6fd13fd57e43a912d8cf3685bf72216336f820ad64a442bd9 Amino-acid sequence for this intervalKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVS

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: P06731

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:10864933, ECO:0000269|PubMed:18086185, ECO:0000269|PubMed:2317824, ECO:0000269|PubMed:2803308, ECO:0000269|PubMed:3387431}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:10864933, ECO:0000269|PubMed:18086185, ECO:0000269|PubMed:2317824, ECO:0000269|PubMed:2803308, ECO:0000269|PubMed:3387431}; Extracellular side {ECO:0000269|PubMed:10864933, ECO:0000269|PubMed:18086185, ECO:0000269|PubMed:2317824, ECO:0000269|PubMed:2803308, ECO:0000269|PubMed:3387431}. Apical cell membrane {ECO:0000269|PubMed:10436421}. Cell surface {ECO:0000269|PubMed:2317824, ECO:0000269|PubMed:2803308}. Note=Localized to the apical glycocalyx surface. {ECO:0000269|PubMed:10436421}.
transmembrane: Not recorded
topological_domain: Not recorded
signal_peptide: SIGNAL 1..34
lipidation: LIPID 676; /note="GPI-anchor amidated alanine"; /evidence="ECO:0000269|PubMed:3387431"

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: Cell adhesion molecule CEACAM5
Protein location: GPI-anchored membrane protein
Canonical sequence: P06731 · 702 amino acids
Extracellular region: An extracellular span at residues 35–675 is derived from the signal peptide and GPI attachment annotation.

More structures and generated models

Structure snapshots

Published reference structure

Where tusamitamab contacts CEACAM5

Deposited structure 8BW0. Ochre residues mark the recorded CEACAM5 contact site within 5 angstroms of the Fab.

PDB entry: 8BW0
Target ID: T-ENSG00000105388

tusamitamab Fab heavy chain · chain H (ribbon)
tusamitamab Fab light chain · chain L (ribbon)
CEACAM5 A3-B3 domains · chain C (ribbon)
CEACAM5 contact residues (sticks)

Download PNG · Download settings · Source coordinates (CIF)

Predicted complex

CEACAM5 · BoltzGen 03

Boltz2-predicted CEACAM5 complex from the three-arm checkpoint. The campaign control gate failed; no candidate was promoted.

Target ID: T-ENSG00000105388

CEACAM5 A3-B3 target construct, 177 residues · chain A (ribbon)
Designed candidate ceacam5-cp3-boltzgen-03 · chain B (ribbon)

Download PNG · Download settings · Source coordinates (PDB)

Predicted complex

CEACAM5 · Proteina–Complexa 02

Target ID: T-ENSG00000105388

CEACAM5 A3-B3 target construct, 177 residues · chain A (ribbon)
Designed candidate ceacam5-cp3-proteina-complexa-02 · chain B (ribbon)

Download PNG · Download settings · Source coordinates (PDB)

Predicted complex

CEACAM5 · Proteina–Complexa 03

Target ID: T-ENSG00000105388

CEACAM5 A3-B3 target construct, 177 residues · chain A (ribbon)
Designed candidate ceacam5-cp3-proteina-complexa-03 · chain B (ribbon)

Download PNG · Download settings · Source coordinates (PDB)

Predicted complex

CEACAM5 · PXDesign–ProteinMPNN 03

Target ID: T-ENSG00000105388

CEACAM5 A3-B3 target construct, 177 residues · chain A (ribbon)
Designed candidate ceacam5-cp3-pxdesign-proteinmpnn-03 · chain B (ribbon)

Download PNG · Download settings · Source coordinates (PDB)

Predicted complex

CEACAM5 · shuffled VH control

Target ID: T-ENSG00000105388

CEACAM5 A3-B3 target construct, 177 residues · chain A (ribbon)
Composition-shuffled VH negative control · chain B (ribbon)

Download PNG · Download settings · Source coordinates (PDB)

Predicted complex

CEACAM5 · paired VH/VL control

Boltz2-predicted CEACAM5 complex with tusamitamab VH and VL, seed 20260931. One positive control completed; the incomplete comparison panel does not establish a paired-versus-single-domain result.

Target ID: T-ENSG00000105388

CEACAM5 target · chain A (ribbon)
Heavy-chain variable domain (VH) · chain B (ribbon)
Light-chain variable domain (VL) · chain C (ribbon)

Download PNG · Download settings · Source coordinates (PDB)

Predicted complex

CEACAM5 · tusamitamab VH control

Target ID: T-ENSG00000105388

CEACAM5 A3-B3 target construct, 177 residues · chain A (ribbon)
Tusamitamab VH positive control · chain B (ribbon)

Download PNG · Download settings · Source coordinates (PDB)

Expression in normal tissues

RNA specificity: Tissue enriched
RNA distribution: Detected in many
RNA tissue-specific nTPM: intestine: 920.3
Protein specificity: Group enriched
Protein distribution: Detected in many
Immunohistochemistry reliability: Enhanced
Immunofluorescence reliability: Supported
Protein tissue-specific intensity: intestine: 49,432,922.2; skin: 22,804,857.5
Tissue cell-type enrichment: Colon - Colon enterocytes, Minor Salivary Gland - Minor salivary gland basal cells, Prostate - Urothelial cells, Skin - Eccrine sweat gland cells, Stomach - Gastric mucous cells, Thyroid gland - Parafollicular cells
Subcellular location: Plasma membrane

Human Protein Atlas: CEACAM5

Structures

Structures records linked to CEACAM5.
Name	Stable ID	Action	Format	Status	Claim
8BW0	S-RCSB-8BW0	Not recorded	Not recorded	not recorded	verified deposited experimental structure

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

CEACAM5 · ENSG00000105388 · P06731