CLDN2

Claudin-2. UniProt annotates extracellular residues 29–81, 138–162.

Sequence and protein regions

Explore the CLDN2 sequence, select annotated regions, and copy a request to continue in Codex.

RNA expression in tumor samples

Median CLDN2 RNA expression by tumor type, measured in RSEM units. The study selected these samples using microsatellite-stability score thresholds.

Mucinous tumors37 samples2,927.4

Other tumor types438 samples1,514.6

Compare the sample groups · cBioPortal measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000165376
UniProt accession: P57739
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 230
Sequence SHA-256: 97f250180f7f70c1c54d1c88f26e3d10406679ca7eb9e317376f6259c7da254d

View and select the full canonical sequence

Canonical amino-acid sequence

MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV

Sequence positions 1–230

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Membrane-spanning segments

8–28 (Helical); 82–102 (Helical); 117–137 (Helical); 163–183 (Helical)

Source-annotated domains

1–7 (Cytoplasmic); 29–81 (Extracellular); 103–116 (Cytoplasmic); 138–162 (Extracellular); 184–230 (Cytoplasmic)

Source-annotated extracellular intervals

29–81; 138–162

UniProt annotates the following extracellular intervals.

One-based positions include both interval endpoints.
Start	End	Length	Sequence and source
29	81	53	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 4b6137f0f917f6ed3b27a7a4ba27dcd445fcd0668a77be9d1f06fbb2c55ca357 Amino-acid sequence for this intervalSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQ
138	162	25	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 0f95a2d91786cd3571b941e8ae7ceb4f3437ce8d97cefc595f360129c8df33a0 Amino-acid sequence for this intervalWNLHGILRDFYSPLVPDSMKFEIGE

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: P57739

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell junction, tight junction {ECO:0000269|PubMed:20460438}. Cell membrane {ECO:0000250|UniProtKB:O88552}; Multi-pass membrane protein {ECO:0000255}.
transmembrane: TRANSMEM 8..28; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 82..102; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 117..137; /note="Helical"; /evidence="ECO:0000255"; TRANSMEM 163..183; /note="Helical"; /evidence="ECO:0000255"
topological_domain: TOPO_DOM 1..7; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 29..81; /note="Extracellular"; /evidence="ECO:0000255"; TOPO_DOM 103..116; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 138..162; /note="Extracellular"; /evidence="ECO:0000255"; TOPO_DOM 184..230; /note="Cytoplasmic"; /evidence="ECO:0000255"
signal_peptide: Not recorded
lipidation: Not recorded

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: Claudin-2
Protein location: Transmembrane protein
Canonical sequence: P57739 · 230 amino acids
Extracellular region: UniProt annotates extracellular residues 29–81, 138–162.

Expression in normal tissues

RNA specificity: Tissue enhanced
RNA distribution: Detected in many
RNA tissue-specific nTPM: choroid plexus: 189.2; gallbladder: 95.3; kidney: 154.2; seminal vesicle: 85.1
Protein specificity: Not detected
Protein distribution: Not detected
Immunohistochemistry reliability: Enhanced
Immunofluorescence reliability: Supported
Tissue cell-type enrichment: Adipose subcutaneous - Adipocytes (Subcutaneous), Adipose visceral - Adipocytes (Visceral), Adrenal gland - Adrenal cortex cells, Breast - Adipocytes (Breast), Kidney - Proximal tubular cells
Subcellular location: Plasma membrane, Cell Junctions

Human Protein Atlas: CLDN2

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

CLDN2 · ENSG00000165376 · P57739