FASLG

Tumor necrosis factor ligand superfamily member 6. UniProt annotates extracellular residues 103–281.

Sequence and protein regions

Explore the FASLG sequence, select annotated regions, and copy a request to continue in Codex.

RNA expression in tumor samples

Median FASLG RNA expression by tumor type, measured in RSEM units. The study selected these samples using microsatellite-stability score thresholds.

Mucinous tumors37 samples4.7

Other tumor types438 samples7.3

Compare the sample groups · cBioPortal measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000117560
UniProt accession: P48023
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 281
Sequence SHA-256: 53a6da74b7f56161c0ca6ecefc9966b7566ee3b75ef1afa0dd752d168b8d4ea0

View and select the full canonical sequence

Canonical amino-acid sequence

MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Sequence positions 1–281

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Membrane-spanning segments

81–102 (Helical; Signal-anchor for type II membrane protein)

Source-annotated domains

1–80 (Cytoplasmic); 103–281 (Extracellular)

Source-annotated extracellular intervals

103–281

UniProt annotates the following extracellular intervals.

One-based positions include both interval endpoints.
Start	End	Length	Sequence and source
103	281	179	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 9ec3f4faa6bccc6f8ac3e188ead7f29ed9808aeeff7eb9b2b9c87e41fbe60bb5 Amino-acid sequence for this intervalQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: P48023

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:17557115, ECO:0000269|PubMed:9427603}; Single-pass type II membrane protein {ECO:0000255}. Cytoplasmic vesicle lumen {ECO:0000269|PubMed:17164290}. Lysosome lumen {ECO:0000269|PubMed:17164290}. Note=Is internalized into multivesicular bodies of secretory lysosomes after phosphorylation by FGR and monoubiquitination (PubMed:17164290). Colocalizes with the SPPL2A protease at the cell membrane (PubMed:17557115). {ECO:0000269|PubMed:17164290, ECO:0000269|PubMed:17557115}.; SUBCELLULAR LOCATION: [Tumor necrosis factor ligand superfamily member 6, soluble form]: Secreted {ECO:0000269|PubMed:9427603}. Note=May be released into the extracellular fluid by cleavage from the cell surface. {ECO:0000269|PubMed:9427603}.; SUBCELLULAR LOCATION: [FasL intracellular domain]: Nucleus {ECO:0000269|PubMed:17557115}. Note=The FasL ICD cytoplasmic form is translocated into the nucleus. {ECO:0000269|PubMed:17557115}.
transmembrane: TRANSMEM 81..102; /note="Helical; Signal-anchor for type II membrane protein"; /evidence="ECO:0000255"
topological_domain: TOPO_DOM 1..80; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 103..281; /note="Extracellular"; /evidence="ECO:0000255"
signal_peptide: Not recorded
lipidation: Not recorded

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: Tumor necrosis factor ligand superfamily member 6
Protein location: Transmembrane protein
Canonical sequence: P48023 · 281 amino acids
Extracellular region: UniProt annotates extracellular residues 103–281.

Expression in normal tissues

RNA specificity: Tissue enhanced
RNA distribution: Detected in some
RNA tissue-specific nTPM: lymphoid tissue: 5.3
Protein specificity: Not detected
Protein distribution: Not detected
Immunohistochemistry reliability: Approved
Tissue cell-type enrichment: Adipose subcutaneous - T-cells, Adipose visceral - T-cells, Adrenal gland - T-cells, Breast - T-cells, Heart muscle - T-cells, Kidney - T-cells, Liver - NK-cells (Liver), Minor Salivary Gland - T-cells, Pituitary gland - T-cells, Prostate - T-cells, Spleen - T-cells, Stomach - T-cells, Thyroid gland - T-cells

Human Protein Atlas: FASLG

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

FASLG · ENSG00000117560 · P48023