LY6G6D

Lymphocyte antigen 6 complex locus protein G6d. An extracellular span at residues 20–103 is derived from the signal peptide and GPI attachment annotation.

Sequence and protein regions

Explore the LY6G6D sequence, select annotated regions, and copy a request to continue in Codex.

Open this view

RNA expression in tumor samples

Median LY6G6D RNA expression by tumor type, measured in RSEM units. The study selected these samples using microsatellite-stability score thresholds.

Mucinous tumors37 samples10.6

Other tumor types438 samples300.6

Compare the sample groups · cBioPortal measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000244355
UniProt accession: O95868
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 133
Sequence SHA-256: b8a20c41b1334b48eecaf80fb3d3781edeaa8088695a1b3546ee5e250a6b2a27

View and select the full canonical sequence

Canonical amino-acid sequence

MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG

Sequence positions 1–133

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Signal peptide

1–19

Lipid attachment sites

104–104 (GPI-anchor amidated serine)

Derived extracellular interval

20–103

The extracellular interval is derived from the signal peptide and GPI attachment site. It is a proposed construct interval.

One-based positions include both interval endpoints.
Start	End	Length	Sequence and source
20	103	84	Sequence and source Basis interval-after-reviewed-signal-before-reviewed-gpi-anchor Evidence class topology-derived-construct-hypothesis Sequence SHA-256 7c67833f69b596f9c086fed1ce150162deca18e565ae35aa8cbe316c4690daeb Amino-acid sequence for this intervalNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCN

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: O95868

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:17008713}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:17008713}. Cell projection, filopodium {ECO:0000269|PubMed:17008713}.
transmembrane: Not recorded
topological_domain: Not recorded
signal_peptide: SIGNAL 1..19; /evidence="ECO:0000255"
lipidation: LIPID 104; /note="GPI-anchor amidated serine"; /evidence="ECO:0000255"

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: Lymphocyte antigen 6 complex locus protein G6d
Protein location: GPI-anchored membrane protein
Canonical sequence: O95868 · 133 amino acids
Extracellular region: An extracellular span at residues 20–103 is derived from the signal peptide and GPI attachment annotation.

Expression in normal tissues

RNA specificity: Tissue enriched
RNA distribution: Detected in some
RNA tissue-specific nTPM: skin 1: 33.5
Protein specificity: Not detected
Protein distribution: Not detected
Immunohistochemistry reliability: Uncertain
Tissue cell-type enrichment: Pituitary gland - Undifferentiated cells (Pituitary gland), Skin - Hair cortex cells, Skin - Inner root sheath cells, Testis - Early spermatids, Testis - Late spermatids

Human Protein Atlas: LY6G6D

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

LY6G6D · ENSG00000244355 · O95868