STEAP4

Metalloreductase STEAP4. The canonical sequence contains 459 amino acids.

Sequence and protein regions

Explore the STEAP4 sequence, select annotated regions, and copy a request to continue in Codex.

RNA expression in tumor samples

Median STEAP4 RNA expression by tumor type, measured in RSEM units. The study selected these samples using microsatellite-stability score thresholds.

Mucinous tumors37 samples69.0

Other tumor types438 samples50.7

Compare the sample groups · cBioPortal measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000127954
UniProt accession: Q687X5
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 459
Sequence SHA-256: 0331f76a837610fb95d1477d0c0026a12ecb1d59557ea19271245330335df031

View and select the full canonical sequence

Canonical amino-acid sequence

MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH

Sequence positions 1–459

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Membrane-spanning segments

202–224 (Helical); 236–256 (Helical); 293–313 (Helical); 342–362 (Helical); 381–401 (Helical); 419–439 (Helical)

This collection has no explicit extracellular interval for this protein.

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: Q687X5

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:15897894, ECO:0000269|PubMed:18430367}; Multi-pass membrane protein {ECO:0000269|PubMed:30337524}. Golgi apparatus membrane {ECO:0000269|PubMed:15897894}; Multi-pass membrane protein {ECO:0000269|PubMed:30337524}. Early endosome membrane {ECO:0000269|PubMed:15897894}; Multi-pass membrane protein {ECO:0000269|PubMed:30337524}.
transmembrane: TRANSMEM 202..224; /note="Helical"; /evidence="ECO:0000269|PubMed:30337524"; TRANSMEM 236..256; /note="Helical"; /evidence="ECO:0000269|PubMed:30337524"; TRANSMEM 293..313; /note="Helical"; /evidence="ECO:0000269|PubMed:30337524"; TRANSMEM 342..362; /note="Helical"; /evidence="ECO:0000269|PubMed:30337524"; TRANSMEM 381..401; /note="Helical"; /evidence="ECO:0000269|PubMed:30337524"; TRANSMEM 419..439; /note="Helical"; /evidence="ECO:0000269|PubMed:30337524"
topological_domain: Not recorded
signal_peptide: Not recorded
lipidation: Not recorded

Download all canonical target sequences (FASTA)

Protein identity and location

Protein: Metalloreductase STEAP4
Protein location: Transmembrane protein
Canonical sequence: Q687X5 · 459 amino acids

Expression in normal tissues

RNA specificity: Tissue enhanced
RNA distribution: Detected in many
RNA tissue-specific nTPM: adipose tissue: 106.6
Protein specificity: Tissue enhanced
Protein distribution: Detected in many
Immunofluorescence reliability: Approved
Protein tissue-specific intensity: lung: 39,370,698.2
Tissue cell-type enrichment: Breast - Endothelial cells, Colon - Endothelial cells, Skeletal muscle - Endothelial cells, Spleen - Neutrophils_2, Stomach - Endothelial cells
Subcellular location: Nucleoplasm, Plasma membrane

Human Protein Atlas: STEAP4

Sources and downloads

UniProt protein record Target measurements (JSON)Sequence annotations (JSON)Target sequences (FASTA)

STEAP4 · ENSG00000127954 · Q687X5