TNFSF4

Tumor necrosis factor ligand superfamily member 4. UniProt annotates extracellular residues 51–183.

Sequence and protein regions

Explore the TNFSF4 sequence, select annotated regions, and copy a request to continue in Codex.

RNA expression in tumor samples

Median TNFSF4 RNA expression by tumor type, measured in RSEM units. The study selected these samples using microsatellite-stability score thresholds.

Mucinous tumors37 samples88.6

Other tumor types438 samples62.6

Compare the sample groups · cBioPortal measurements (JSON)

Sequence & binding sites

Choose a protein region, search amino-acid letters, or inspect a recorded binding site.

Loading sequence…

Open the sequence explorer

Sequence annotations and source records

Canonical sequence and topology

Target ID: T-ENSG00000117586
UniProt accession: P23510
Sequence state: available
Canonical sequence: Yes
Length in amino acids: 183
Sequence SHA-256: 021fcbfe8a49f5b28561822ae8edf218c3793e066da31f35cf764dac8a623fcf

View and select the full canonical sequence

Canonical amino-acid sequence

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Sequence positions 1–183

Gray shows the full canonical sequence. Colored spans mark the listed intervals.

Membrane-spanning segments

24–50 (Helical; Signal-anchor for type II membrane protein)

Source-annotated domains

1–23 (Cytoplasmic); 51–183 (Extracellular)

Source-annotated extracellular intervals

51–183

UniProt annotates the following extracellular intervals.

One-based positions include both interval endpoints.
Start	End	Length	Sequence and source
51	183	133	Sequence and source Basis reviewed-uniprot-topological-domain Evidence class source-annotated-topology Sequence SHA-256 fb8c8bb956f323c0a246687d6d86c0129307aec16d264b8c96be3d7a38090fec Amino-acid sequence for this intervalQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Sequence and topology sources

Source role: canonical-sequence
Source: alphafold-db-canonical-uniprot-field
Extracted field: uniprotSequence
Source row accession: Not recorded

Download source snapshot

Open sequence source

Source role: reviewed-topology
Source: UniProt reviewed human surface-field snapshot
Extracted field: Not recorded
Source row accession: P23510

Download source snapshot (gzip)

subcellular_location: SUBCELLULAR LOCATION: Membrane; Single-pass type II membrane protein.
transmembrane: TRANSMEM 24..50; /note="Helical; Signal-anchor for type II membrane protein"; /evidence="ECO:0000255"
topological_domain: TOPO_DOM 1..23; /note="Cytoplasmic"; /evidence="ECO:0000255"; TOPO_DOM 51..183; /note="Extracellular"; /evidence="ECO:0000255"
signal_peptide: Not recorded
lipidation: Not recorded

Download all canonical target sequences (FASTA)